C9orf117 polyclonal antibody
  • C9orf117 polyclonal antibody

C9orf117 polyclonal antibody

Ref: AB-PAB21453
C9orf117 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C9orf117.
Información adicional
Size 100 uL
Gene Name C9orf117
Gene Alias -
Gene Description chromosome 9 open reading frame 117
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DNQALKSQRDQLSLQLEQQQVDLQRLQQELANEQKVRASLEAALVQATSFLQNILQMHRDEEDSDVDVTFQPWHKEMLQQLLVMLSST
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C9orf117.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 286207
Iso type IgG

Enviar uma mensagem


C9orf117 polyclonal antibody

C9orf117 polyclonal antibody