SETD1B polyclonal antibody
  • SETD1B polyclonal antibody

SETD1B polyclonal antibody

Ref: AB-PAB21443
SETD1B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SETD1B.
Información adicional
Size 100 uL
Gene Name SETD1B
Gene Alias FLJ20803|KIAA1076|KMT2G|Set1B
Gene Description SET domain containing 1B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq DSLGMEEEVDIETEAVAPEERPSMLDEPPLPVGVEEPADSREPPEEPGLSQEGAMLLSPEPPAKEVEARPPLSPER
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SETD1B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23067
Iso type IgG

Enviar uma mensagem


SETD1B polyclonal antibody

SETD1B polyclonal antibody