SLC10A3 polyclonal antibody
  • SLC10A3 polyclonal antibody

SLC10A3 polyclonal antibody

Ref: AB-PAB21440
SLC10A3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC10A3.
Información adicional
Size 100 uL
Gene Name SLC10A3
Gene Alias DXS253E|P3
Gene Description solute carrier family 10 (sodium/bile acid cotransporter family), member 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq DSEGIIVISSQYPGQANRTAPGPMLRVTSLDTEVLTIKNVSAITWGGGGGFVVSIHSGLAGLAPLHIQLVDAHEAPPTLIEERRDFCIKVSPAEDTPATLSADLAHFSENPILYLLLPLIFVNKCSFGCKVELEVLKGLMQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC10A3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 8273
Iso type IgG

Enviar uma mensagem


SLC10A3 polyclonal antibody

SLC10A3 polyclonal antibody