ZNF750 polyclonal antibody
  • ZNF750 polyclonal antibody

ZNF750 polyclonal antibody

Ref: AB-PAB21432
ZNF750 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF750.
Información adicional
Size 100 uL
Gene Name ZNF750
Gene Alias FLJ13841|MGC125667|MGC125668|Zfp750
Gene Description zinc finger protein 750
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ACAVDSSEEQKQTAAVALCQLAAYSPRNIRVGDGDAAAPEPACRQDTPTLSSMESQEAQCDLRPKGQKRTSLRDAGKSQQGAKKAKLQDTARVFTLRRRAR
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF750.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79755
Iso type IgG

Enviar uma mensagem


ZNF750 polyclonal antibody

ZNF750 polyclonal antibody