SLC43A2 polyclonal antibody
  • SLC43A2 polyclonal antibody

SLC43A2 polyclonal antibody

Ref: AB-PAB21430
SLC43A2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC43A2.
Información adicional
Size 100 uL
Gene Name SLC43A2
Gene Alias FLJ23848|LAT4|MGC34680
Gene Description solute carrier family 43, member 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq YRRQLERQLQQRQEDDKLFLKINGSSNQEAFV
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC43A2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 124935
Iso type IgG

Enviar uma mensagem


SLC43A2 polyclonal antibody

SLC43A2 polyclonal antibody