MAK10 polyclonal antibody
  • MAK10 polyclonal antibody

MAK10 polyclonal antibody

Ref: AB-PAB21426
MAK10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MAK10.
Información adicional
Size 100 uL
Gene Name MAK10
Gene Alias FLJ21613|FLJ22643|bA379P1.1
Gene Description MAK10 homolog, amino-acid N-acetyltransferase subunit (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq KKVRPLSREITMSQAYQNMCAGMFKTMVAFDMDGKVRKPKFELDSEQVRYEHRFAPFNSVMTPPPVHYLQFKEMSDLNKYSPPPQSPELYVAASKHFQQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MAK10.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 60560
Iso type IgG

Enviar uma mensagem


MAK10 polyclonal antibody

MAK10 polyclonal antibody