TOP1MT polyclonal antibody
  • TOP1MT polyclonal antibody

TOP1MT polyclonal antibody

Ref: AB-PAB21425
TOP1MT polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TOP1MT.
Información adicional
Size 100 uL
Gene Name TOP1MT
Gene Alias 2900052H09Rik
Gene Description topoisomerase (DNA) I, mitochondrial
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq ARWEKEKHEDGVKWRQLEHKGPYFAPPYEPLPDGVRFFYEGRPVRLSVAAEEVATFYGRMLDHEYTTKEVFRKNFFNDWRKEMAVEEREVIKSLDKCDFTEIHR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TOP1MT.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 116447
Iso type IgG

Enviar uma mensagem


TOP1MT polyclonal antibody

TOP1MT polyclonal antibody