HSD17B4 polyclonal antibody
  • HSD17B4 polyclonal antibody

HSD17B4 polyclonal antibody

Ref: AB-PAB21417
HSD17B4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HSD17B4.
Información adicional
Size 100 uL
Gene Name HSD17B4
Gene Alias DBP|MFE-2|SDR8C1
Gene Description hydroxysteroid (17-beta) dehydrogenase 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq VNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSRMTQTVMPEDLVEALKPEYVAPLV
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HSD17B4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3295
Iso type IgG

Enviar uma mensagem


HSD17B4 polyclonal antibody

HSD17B4 polyclonal antibody