SMAP2 polyclonal antibody
  • SMAP2 polyclonal antibody

SMAP2 polyclonal antibody

Ref: AB-PAB21413
SMAP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SMAP2.
Información adicional
Size 100 uL
Gene Name SMAP2
Gene Alias RP1-228H13.3|SMAP1L
Gene Description small ArfGAP2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq ASGMVAPMAMPAGYMGGMQASMMGVPNGMMTTQQAGYMAGMAAMPQTVYGVQPAQQLQWNLTQMTQQMAGMNFYGANGMMNYGQSMSGGNGQAANQTLSPQMWK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SMAP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64744
Iso type IgG

Enviar uma mensagem


SMAP2 polyclonal antibody

SMAP2 polyclonal antibody