PHF12 polyclonal antibody
  • PHF12 polyclonal antibody

PHF12 polyclonal antibody

Ref: AB-PAB21402
PHF12 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PHF12.
Información adicional
Size 100 uL
Gene Name PHF12
Gene Alias FLJ34122|KIAA1523|MGC131914|PF1
Gene Description PHD finger protein 12
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq GGAVNMCYRTLYIGTGADMDVCLTNYGHCNYVSGKHACIFYDENTKHYELLNYSEHGTTVDNVLYSCDFSEKTPPTPPSSIVAKVQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PHF12.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57649
Iso type IgG

Enviar uma mensagem


PHF12 polyclonal antibody

PHF12 polyclonal antibody