INSL6 polyclonal antibody
  • INSL6 polyclonal antibody

INSL6 polyclonal antibody

Ref: AB-PAB21394
INSL6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant INSL6.
Información adicional
Size 100 uL
Gene Name INSL6
Gene Alias RIF1
Gene Description insulin-like 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq SARKLCGRYLVKEIEKLCGHANWSQFRFEEETPFSRLIAQASEKVEAYSPYQFESPQTASPARGRGTNPVSTSWEEAVNSWEMQSLPEYKD
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human INSL6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 11172
Iso type IgG

Enviar uma mensagem


INSL6 polyclonal antibody

INSL6 polyclonal antibody