RP11-738I14.8 polyclonal antibody
  • RP11-738I14.8 polyclonal antibody

RP11-738I14.8 polyclonal antibody

Ref: AB-PAB21393
RP11-738I14.8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RP11-738I14.8.
Información adicional
Size 100 uL
Gene Name RP11-738I14.8
Gene Alias FLJ46082|MGC148067
Gene Description FLJ46082 protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EKKQKVVLGKLYETRSSQLRKYKPPVKLDTLWHMPHFQKVGRHLDTFPTEADRQRALKAHREECAVRQGTLRMGNYTH
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RP11-738I14.8.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 389799
Iso type IgG

Enviar uma mensagem


RP11-738I14.8 polyclonal antibody

RP11-738I14.8 polyclonal antibody