IER5L polyclonal antibody
  • IER5L polyclonal antibody

IER5L polyclonal antibody

Ref: AB-PAB21392
IER5L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant IER5L.
Información adicional
Size 100 uL
Gene Name IER5L
Gene Alias MGC70833|bA247A12.2
Gene Description immediate early response 5-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PSDFGLHCSSQTTVLDLDTHVVTTVENGYLHQDCCASAHCPCCGQGAPGPGLASAAGCKRKYYPGQEEEEDDEEDAG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human IER5L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 389792
Iso type IgG

Enviar uma mensagem


IER5L polyclonal antibody

IER5L polyclonal antibody