LRWD1 polyclonal antibody
  • LRWD1 polyclonal antibody

LRWD1 polyclonal antibody

Ref: AB-PAB21390
LRWD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LRWD1.
Información adicional
Size 100 uL
Gene Name LRWD1
Gene Alias DKFZp434K1815
Gene Description leucine-rich repeats and WD repeat domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PFLTVNDNLKVSFLLPTLRKVNGKDASSTYSQVENLNRELTSRVTAHWEKFMATLGPEEEAEKAQADFVKSAVRD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRWD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 222229
Iso type IgG

Enviar uma mensagem


LRWD1 polyclonal antibody

LRWD1 polyclonal antibody