DLG2 polyclonal antibody
  • DLG2 polyclonal antibody

DLG2 polyclonal antibody

Ref: AB-PAB21384
DLG2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DLG2.
Información adicional
Size 100 uL
Gene Name DLG2
Gene Alias DKFZp781D1854|DKFZp781E0954|FLJ37266|MGC131811|PSD-93|PSD93|chapsyn-110
Gene Description discs, large homolog 2 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KVGKPTTIYMTDPYGPPDITHSYSPPMENHLLSGNNGTLEYKTSLPPISPGRYSPIPKHMLVDDDYTRPPEPVYSTVNKLCDKP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DLG2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1740
Iso type IgG

Enviar uma mensagem


DLG2 polyclonal antibody

DLG2 polyclonal antibody