AAED1 polyclonal antibody
  • AAED1 polyclonal antibody

AAED1 polyclonal antibody

Ref: AB-PAB21381
AAED1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant AAED1.
Información adicional
Size 100 uL
Gene Name AAED1
Gene Alias RP11-392G7.2|C9orf21
Gene Description AhpC/TSA antioxidant enzyme domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SFLQEANVTLIVIGQSSYHHIEPFCKLTGYSHEIYVDPEREIYKRLGMKRGEEIASSGQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human AAED1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 195827
Iso type IgG

Enviar uma mensagem


AAED1 polyclonal antibody

AAED1 polyclonal antibody