RNF208 polyclonal antibody
  • RNF208 polyclonal antibody

RNF208 polyclonal antibody

Ref: AB-PAB21376
RNF208 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RNF208.
Información adicional
Size 100 uL
Gene Name RNF208
Gene Alias DKFZp761H1710|MGC88636
Gene Description ring finger protein 208
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EGAPHTPPLPRRPRKGSSELGFPRVAPEDEVIVNQYVIRPGPSASAASSAAAGEPLECPTCGHSYNVTQRRPRVLSCLHSVCEQC
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RNF208.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 727800
Iso type IgG

Enviar uma mensagem


RNF208 polyclonal antibody

RNF208 polyclonal antibody