COX19 polyclonal antibody
  • COX19 polyclonal antibody

COX19 polyclonal antibody

Ref: AB-PAB21370
COX19 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant COX19.
Información adicional
Size 100 uL
Gene Name COX19
Gene Alias MGC104475
Gene Description COX19 cytochrome c oxidase assembly homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq NFGTKSFQPRPPDKGSFPLDHLGECKSFKEKFMKCLHNNNFENALCRKESKEYLECRMERKLMLQEPLEKLGFGD
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human COX19.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 90639
Iso type IgG

Enviar uma mensagem


COX19 polyclonal antibody

COX19 polyclonal antibody