RGP1 polyclonal antibody
  • RGP1 polyclonal antibody

RGP1 polyclonal antibody

Ref: AB-PAB21355
RGP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RGP1.
Información adicional
Size 100 uL
Gene Name RGP1
Gene Alias KIAA0258
Gene Description RGP1 retrograde golgi transport homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SKSYSYSEVLPIEGPPSFRGQSVKYVYKLTIGCQRVNSPITLLRVPLRVLVLTGLQDVRFPQDEAVAPSSPFLEEDEGGKKDS
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RGP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9827
Iso type IgG

Enviar uma mensagem


RGP1 polyclonal antibody

RGP1 polyclonal antibody