GTPBP10 polyclonal antibody
  • GTPBP10 polyclonal antibody

GTPBP10 polyclonal antibody

Ref: AB-PAB21354
GTPBP10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GTPBP10.
Información adicional
Size 100 uL
Gene Name GTPBP10
Gene Alias DKFZp686A10121|FLJ38242|MGC104191|ObgH2|UG0751c10
Gene Description GTP-binding protein 10 (putative)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq ALKGSKGKDCEIPVPVGISVTDENGKIIGELNKENDRILVAQGGLGGKLLTNFLPLKGQKRIIHLDLKLIADVGLVGFPNAGKSSLLSCVSHAKPAIADYAF
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GTPBP10.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 85865
Iso type IgG

Enviar uma mensagem


GTPBP10 polyclonal antibody

GTPBP10 polyclonal antibody