TPST2 polyclonal antibody
  • TPST2 polyclonal antibody

TPST2 polyclonal antibody

Ref: AB-PAB21351
TPST2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TPST2.
Información adicional
Size 100 uL
Gene Name TPST2
Gene Alias -
Gene Description tyrosylprotein sulfotransferase 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq IAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDCLTKWNKAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVLHHEDLIGKPGGVSLSKIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGY
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TPST2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 8459
Iso type IgG

Enviar uma mensagem


TPST2 polyclonal antibody

TPST2 polyclonal antibody