BAT2L polyclonal antibody
  • BAT2L polyclonal antibody

BAT2L polyclonal antibody

Ref: AB-PAB21349
BAT2L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BAT2L.
Información adicional
Size 100 uL
Gene Name BAT2L
Gene Alias DKFZp781F05101|DKFZp781K12107|KIAA0515|LQFBS-1|MGC10526
Gene Description HLA-B associated transcript 2-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EREESTLKKGDCRDSWRSNKGCSEDHSGLDAKSRGPRAFGRALPPRLSNCGYGRRTFVSKESPHWQSKSPGSSWQEYGPSDTCGSRRPTDRDYVPDSYRHPDAFGGR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BAT2L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84726
Iso type IgG

Enviar uma mensagem


BAT2L polyclonal antibody

BAT2L polyclonal antibody