MURC polyclonal antibody
  • MURC polyclonal antibody

MURC polyclonal antibody

Ref: AB-PAB21348
MURC polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MURC.
Información adicional
Size 100 uL
Gene Name MURC
Gene Alias -
Gene Description muscle-restricted coiled-coil protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KVSAHIKDVKARVEKQQIHVKKVEVKQEEIMKKNKFRVVIFQEKFRCPTSLSVVKDRNLTENQEEDDDDIFDPPVDLSSDEEYYVE
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MURC.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 347273
Iso type IgG

Enviar uma mensagem


MURC polyclonal antibody

MURC polyclonal antibody