ZNF233 polyclonal antibody
  • ZNF233 polyclonal antibody

ZNF233 polyclonal antibody

Ref: AB-PAB21343
ZNF233 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF233.
Información adicional
Size 100 uL
Gene Name ZNF233
Gene Alias FLJ38032
Gene Description zinc finger protein 233
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq GKGIGYSSGLPRHQCFHIGEKCYRNGDSGEGFSQGSHLQPHQRVSTGENLYRCQVYARSSNQNSCLPS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF233.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 353355
Iso type IgG

Enviar uma mensagem


ZNF233 polyclonal antibody

ZNF233 polyclonal antibody