FAM29A polyclonal antibody
  • FAM29A polyclonal antibody

FAM29A polyclonal antibody

Ref: AB-PAB21339
FAM29A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM29A.
Información adicional
Size 100 uL
Gene Name FAM29A
Gene Alias Dgt6|MGC102696|MGC138798|MGC138799|RP11-296P7.3
Gene Description family with sequence similarity 29, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq HHFVETFNIKPQDLHKCIARCHFARSRFLQILQRQDCVTQKYQENAQLSVKQVRNLRSECIGLENQIKKMEPYDDHSNMEEKIQKVRSLWASVN
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM29A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54801
Iso type IgG

Enviar uma mensagem


FAM29A polyclonal antibody

FAM29A polyclonal antibody