SFXN4 polyclonal antibody
  • SFXN4 polyclonal antibody

SFXN4 polyclonal antibody

Ref: AB-PAB21334
SFXN4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SFXN4.
Información adicional
Size 100 uL
Gene Name SFXN4
Gene Alias BCRM1
Gene Description sideroflexin 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq KYGLTGPWIKRLLPVIFLVQASGMNVYMSRSLESIKGIAVMDKEGNVLGHSRIAGTKAVRET
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SFXN4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 119559
Iso type IgG

Enviar uma mensagem


SFXN4 polyclonal antibody

SFXN4 polyclonal antibody