GUCY1B3 polyclonal antibody
  • GUCY1B3 polyclonal antibody

GUCY1B3 polyclonal antibody

Ref: AB-PAB21333
GUCY1B3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GUCY1B3.
Información adicional
Size 100 uL
Gene Name GUCY1B3
Gene Alias GC-S-beta-1|GC-SB3|GUC1B3|GUCB3|GUCSB3|GUCY1B1
Gene Description guanylate cyclase 1, soluble, beta 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq HALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGII
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GUCY1B3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2983
Iso type IgG

Enviar uma mensagem


GUCY1B3 polyclonal antibody

GUCY1B3 polyclonal antibody