ZNF250 polyclonal antibody
  • ZNF250 polyclonal antibody

ZNF250 polyclonal antibody

Ref: AB-PAB21331
ZNF250 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF250.
Información adicional
Size 100 uL
Gene Name ZNF250
Gene Alias FLJ57354|MGC111123|MGC9718|ZFP647|ZNF647
Gene Description zinc finger protein 250
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq SPKPLISEQTVILGKTPLGRIDQENNETKQSFCLSPNSVDHREVQVLSQSMPLTPHQAVPSGERPYMCVECGKCFGRSSH
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF250.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 58500
Iso type IgG

Enviar uma mensagem


ZNF250 polyclonal antibody

ZNF250 polyclonal antibody