WDR60 polyclonal antibody
  • WDR60 polyclonal antibody

WDR60 polyclonal antibody

Ref: AB-PAB21315
WDR60 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant WDR60.
Información adicional
Size 100 uL
Gene Name WDR60
Gene Alias FLJ10300|FLJ23575
Gene Description WD repeat domain 60
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DIQTEEIETREVWTQHPGESTVVSGGSEQRDTSDAVVMPKIDTPRLCSFLRAACQVMAVLLEEDRLAAEPSWNLRAQDRALYFSDSSSQLNTSLPFLQNRKVSSLHTSRVQRQMVVSVH
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human WDR60.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55112
Iso type IgG

Enviar uma mensagem


WDR60 polyclonal antibody

WDR60 polyclonal antibody