NCKAP1 polyclonal antibody
  • NCKAP1 polyclonal antibody

NCKAP1 polyclonal antibody

Ref: AB-PAB21299
NCKAP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NCKAP1.
Información adicional
Size 100 uL
Gene Name NCKAP1
Gene Alias FLJ11291|HEM2|KIAA0587|MGC8981|NAP1|NAP125
Gene Description NCK-associated protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq LSFRSLAQEALRDVLSYHIPFLVSSIEDFKDHIPRETDMKVAMNVYELSSAAGLPCEIDPALVVALSSQKSENISPEEEY
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NCKAP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10787
Iso type IgG

Enviar uma mensagem


NCKAP1 polyclonal antibody

NCKAP1 polyclonal antibody