RSBN1L polyclonal antibody
  • RSBN1L polyclonal antibody

RSBN1L polyclonal antibody

Ref: AB-PAB21293
RSBN1L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RSBN1L.
Información adicional
Size 100 uL
Gene Name RSBN1L
Gene Alias FLJ42526|FLJ45813|MGC71764
Gene Description round spermatid basic protein 1-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq KRPKMYSKSIQTICSGLLTDVEDQAAKGILNDNIKDYVGKNLDTKNYDSKIPENSEFPFVSLKEPRVQNNLKRLDTLEFKQLIHIEHQPNGGASVIHAYSNELSHLS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RSBN1L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 222194
Iso type IgG

Enviar uma mensagem


RSBN1L polyclonal antibody

RSBN1L polyclonal antibody