TMEM168 polyclonal antibody
  • TMEM168 polyclonal antibody

TMEM168 polyclonal antibody

Ref: AB-PAB21291
TMEM168 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM168.
Información adicional
Size 100 uL
Gene Name TMEM168
Gene Alias DKFZp564C012|FLJ13576
Gene Description transmembrane protein 168
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VLDSENSTPWVKEVRKINDQYIAVQGAELIKTVDIEEADPPQLGDFTKDWVEYNCNSSNNICWTEKGRTVK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM168.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64418
Iso type IgG

Enviar uma mensagem


TMEM168 polyclonal antibody

TMEM168 polyclonal antibody