SLIRP polyclonal antibody
  • SLIRP polyclonal antibody

SLIRP polyclonal antibody

Ref: AB-PAB21287
SLIRP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLIRP.
Información adicional
Size 100 uL
Gene Name SLIRP
Gene Alias DC23|C14orf156|DC50|PD04872
Gene Description SRA stem-loop interacting RNA binding protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq LRRSINQPVAFVRRIPWTAASSQLKEHFAQFGHVRRCILPFDKETGFHRGLGWVQFSSEEGLRNALQQENHIIDGVKVQVHTRRPKLPQTSDD
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLIRP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 81892
Iso type IgG

Enviar uma mensagem


SLIRP polyclonal antibody

SLIRP polyclonal antibody