MPDZ polyclonal antibody
  • MPDZ polyclonal antibody

MPDZ polyclonal antibody

Ref: AB-PAB21285
MPDZ polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MPDZ.
Información adicional
Size 100 uL
Gene Name MPDZ
Gene Alias DKFZp781P216|FLJ25909|FLJ34626|FLJ90240|MUPP1
Gene Description multiple PDZ domain protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq VVNILKELPIEVTMVCCRRTVPPTTQSELDSLDLCDIELTEKPHVDLGEFIGSSETEDPVLAMTDAGQSTEEVQAPLAMWEAGIQHIELEKGSKGLGFS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MPDZ.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 8777
Iso type IgG

Enviar uma mensagem


MPDZ polyclonal antibody

MPDZ polyclonal antibody