PPP1R15A polyclonal antibody
  • PPP1R15A polyclonal antibody

PPP1R15A polyclonal antibody

Ref: AB-PAB21284
PPP1R15A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PPP1R15A.
Información adicional
Size 100 uL
Gene Name PPP1R15A
Gene Alias GADD34
Gene Description protein phosphatase 1, regulatory (inhibitor) subunit 15A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QPGEDTEEEEDEDSDTGSAEDEREAETSASTPPASAFLKAWVYRPGEDTEEEEDEDVDSEDKEDDSEAALGEAESDPHPSHPDQRAHFRGWGYRPGKETEEEEAAEDWGEAEPCP
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PPP1R15A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23645
Iso type IgG

Enviar uma mensagem


PPP1R15A polyclonal antibody

PPP1R15A polyclonal antibody