AMZ1 polyclonal antibody
  • AMZ1 polyclonal antibody

AMZ1 polyclonal antibody

Ref: AB-PAB21283
AMZ1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant AMZ1.
Información adicional
Size 100 uL
Gene Name AMZ1
Gene Alias KIAA1950
Gene Description archaelysin family metallopeptidase 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AIKEHERWLAMCIQALQREVAEEDLVQVDRAVDALDRWEMFTGQLPATRQDPPSSRDSVGLRKVLGDKFSSLRRKLSARKLARAESAPRPWDG
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human AMZ1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 155185
Iso type IgG

Enviar uma mensagem


AMZ1 polyclonal antibody

AMZ1 polyclonal antibody