TSPAN33 polyclonal antibody
  • TSPAN33 polyclonal antibody

TSPAN33 polyclonal antibody

Ref: AB-PAB21281
TSPAN33 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TSPAN33.
Información adicional
Size 100 uL
Gene Name TSPAN33
Gene Alias MGC50844|PEN
Gene Description tetraspanin 33
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NAIVHYRDDLDLQNLIDFGQKKFSCCGGISYKDWSQNMYFNCSEDNPSRERCSVPYSCCLPTPDQAVINTMCGQGMQAFDYLEASKVIYTNGCIDKLVNWIHSNLFL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TSPAN33.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 340348
Iso type IgG

Enviar uma mensagem


TSPAN33 polyclonal antibody

TSPAN33 polyclonal antibody