DDX25 polyclonal antibody
  • DDX25 polyclonal antibody

DDX25 polyclonal antibody

Ref: AB-PAB21279
DDX25 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DDX25.
Información adicional
Size 100 uL
Gene Name DDX25
Gene Alias GRTH
Gene Description DEAD (Asp-Glu-Ala-Asp) box polypeptide 25
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq NSHFSNLSQPRKNLWGIKSTAVRNIDGSINNINEDDEEDVVDLAANSLLNKLIHQSLVESSHRVEVLQKDPSSP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DDX25.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 29118
Iso type IgG

Enviar uma mensagem


DDX25 polyclonal antibody

DDX25 polyclonal antibody