C7orf25 polyclonal antibody
  • C7orf25 polyclonal antibody

C7orf25 polyclonal antibody

Ref: AB-PAB21276
C7orf25 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C7orf25.
Información adicional
Size 100 uL
Gene Name C7orf25
Gene Alias FLJ21167|MGC2821
Gene Description chromosome 7 open reading frame 25
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GPGERERATVLIKRINVVPDQPSERALRLVASSKINSRSLTIFGTGDTLKAITMTANSGFVRAANNQGVKFSVFIHQPRALTESKEALATPLPKDYTTD
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C7orf25.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79020
Iso type IgG

Enviar uma mensagem


C7orf25 polyclonal antibody

C7orf25 polyclonal antibody