KLHDC10 polyclonal antibody
  • KLHDC10 polyclonal antibody

KLHDC10 polyclonal antibody

Ref: AB-PAB21275
KLHDC10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KLHDC10.
Información adicional
Size 100 uL
Gene Name KLHDC10
Gene Alias KIAA0265|slim
Gene Description kelch domain containing 10
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq EWTQLKPNNLSCDLPEERYRHEIAHDGQRIYILGGGTSWTAYSLNKIHAYNLETNAWEEIATKPHEKIGFPAARRCHSCVQIK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KLHDC10.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23008
Iso type IgG

Enviar uma mensagem


KLHDC10 polyclonal antibody

KLHDC10 polyclonal antibody