LSM8 polyclonal antibody
  • LSM8 polyclonal antibody

LSM8 polyclonal antibody

Ref: AB-PAB21274
LSM8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LSM8.
Información adicional
Size 100 uL
Gene Name LSM8
Gene Alias YJR022W
Gene Description LSM8 homolog, U6 small nuclear RNA associated (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVIGEIDEETDSALDLGNIRAEP
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LSM8.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51691
Iso type IgG

Enviar uma mensagem


LSM8 polyclonal antibody

LSM8 polyclonal antibody