CCDC146 polyclonal antibody
  • CCDC146 polyclonal antibody

CCDC146 polyclonal antibody

Ref: AB-PAB21269
CCDC146 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCDC146.
Información adicional
Size 100 uL
Gene Name CCDC146
Gene Alias KIAA1505
Gene Description coiled-coil domain containing 146
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq ELSMKQALTIELQKEVREKEDFIFTCNSRIEKGLPLNKEIEKEWLKVLRDEEMHALAIAEKSQEFLEADNRQLPNGVYTTAEQRPNAYIPEADATLPLPKPYGALAPFKPSEPGANMRHIRKPVIKPVEI
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCDC146.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57639
Iso type IgG

Enviar uma mensagem


CCDC146 polyclonal antibody

CCDC146 polyclonal antibody