ZNF592 polyclonal antibody
  • ZNF592 polyclonal antibody

ZNF592 polyclonal antibody

Ref: AB-PAB21261
ZNF592 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF592.
Información adicional
Size 100 uL
Gene Name ZNF592
Gene Alias KIAA0211|MGC138437|MGC138439
Gene Description zinc finger protein 592
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq EVPVEEHFPEAGTNSGSPQGARKGDESMTKASDSSSPSCSSGPRVPKGAAPGSQTGKKQQSTALQASTLAPANLLPKAVHLANLNLVPHSVAASVTAKSSVQRRSQP
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF592.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9640
Iso type IgG

Enviar uma mensagem


ZNF592 polyclonal antibody

ZNF592 polyclonal antibody