PPM1L polyclonal antibody
  • PPM1L polyclonal antibody

PPM1L polyclonal antibody

Ref: AB-PAB21258
PPM1L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PPM1L.
Información adicional
Size 100 uL
Gene Name PPM1L
Gene Alias MGC132545|MGC132547|PP2C-epsilon|PP2CE|PPM1-LIKE
Gene Description protein phosphatase 1 (formerly 2C)-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq DLDKLQPEFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGCPDNITVMVVKFRNSSK
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PPM1L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 151742
Iso type IgG

Enviar uma mensagem


PPM1L polyclonal antibody

PPM1L polyclonal antibody