TRIM50 polyclonal antibody
  • TRIM50 polyclonal antibody

TRIM50 polyclonal antibody

Ref: AB-PAB21252
TRIM50 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TRIM50.
Información adicional
Size 100 uL
Gene Name TRIM50
Gene Alias FLJ32804|MGC138357|MGC138359|TRIM50A
Gene Description tripartite motif-containing 50
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq AFSPISFKPGLHQADIKLTVWKRLFRKVLPAPEPLKLDPATAHPLLELSKGNTVVQCGLLAQRRASQPERFDYSTC
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TRIM50.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 135892
Iso type IgG

Enviar uma mensagem


TRIM50 polyclonal antibody

TRIM50 polyclonal antibody