ARHGAP23 polyclonal antibody
  • ARHGAP23 polyclonal antibody

ARHGAP23 polyclonal antibody

Ref: AB-PAB21244
ARHGAP23 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ARHGAP23.
Información adicional
Size 100 uL
Gene Name ARHGAP23
Gene Alias KIAA1501
Gene Description Rho GTPase activating protein 23
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MNLGFGDESPEPEASGRGERLGRKVAPLATTEDSLASIPFIDEPTSPSIDLQAKHVPASAVVSSAMNSAPVLGTSPSS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ARHGAP23.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57636
Iso type IgG

Enviar uma mensagem


ARHGAP23 polyclonal antibody

ARHGAP23 polyclonal antibody