SLC22A15 polyclonal antibody
  • SLC22A15 polyclonal antibody

SLC22A15 polyclonal antibody

Ref: AB-PAB21238
SLC22A15 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC22A15.
Información adicional
Size 100 uL
Gene Name SLC22A15
Gene Alias DKFZp761G0313|FLIPT1|PRO34686
Gene Description solute carrier family 22, member 15
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ESPRWLYSQGRLSEAEEALYLIAKRNRKLKCTFSLTHPANRSCRETGSFLDLFR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC22A15.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55356
Iso type IgG

Enviar uma mensagem


SLC22A15 polyclonal antibody

SLC22A15 polyclonal antibody