FAM40B polyclonal antibody
  • FAM40B polyclonal antibody

FAM40B polyclonal antibody

Ref: AB-PAB21228
FAM40B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM40B.
Información adicional
Size 100 uL
Gene Name FAM40B
Gene Alias -
Gene Description family with sequence similarity 40, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GFEHLQTLKVQKRAELGLPPLAEDSIQVVKSMRAASPPSYTLDLGESQLAPPPSKLRGRRGSRRQLLTKQDSLDIY
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM40B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57464
Iso type IgG

Enviar uma mensagem


FAM40B polyclonal antibody

FAM40B polyclonal antibody