TDRKH polyclonal antibody
  • TDRKH polyclonal antibody

TDRKH polyclonal antibody

Ref: AB-PAB21225
TDRKH polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TDRKH.
Información adicional
Size 100 uL
Gene Name TDRKH
Gene Alias TDRD2
Gene Description tudor and KH domain containing
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NTSSSMEPTAPLVTPPPKGGGDMAVVVSKEGSWEKPSDDSFQKSEAQAIPEMPMFEIPSPDFSFHADEYLEVYVSASEHPNHFWIQIVGSRSLQLDKLVNEMTQHYENSVPEDLTVHVGDIVAAPLPTNGSWYRARVLGTLENGNLDL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TDRKH.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 11022
Iso type IgG

Enviar uma mensagem


TDRKH polyclonal antibody

TDRKH polyclonal antibody