ABCG8 polyclonal antibody
  • ABCG8 polyclonal antibody

ABCG8 polyclonal antibody

Ref: AB-PAB21219
ABCG8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ABCG8.
Información adicional
Size 100 uL
Gene Name ABCG8
Gene Alias GBD4|MGC142217|STSL
Gene Description ATP-binding cassette, sub-family G (WHITE), member 8
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HMVQYFTAIGYPCPRYSNPADFYVDLTSIDRRSREQELATREKAQSLAALFLEKVRDLDDFLWKAETKDLDEDTCVESSVTPLDTNCLPSPTKMPGAVQQFTTLIRRQISNDFRDLP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ABCG8.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64241
Iso type IgG

Enviar uma mensagem


ABCG8 polyclonal antibody

ABCG8 polyclonal antibody